Spaces:
Running
Running
Update index.html
Browse files- index.html +276 -16
index.html
CHANGED
|
@@ -1,19 +1,279 @@
|
|
| 1 |
<!DOCTYPE html>
|
| 2 |
<html>
|
| 3 |
-
|
| 4 |
-
|
| 5 |
-
|
| 6 |
-
|
| 7 |
-
|
| 8 |
-
|
| 9 |
-
|
| 10 |
-
|
| 11 |
-
|
| 12 |
-
|
| 13 |
-
|
| 14 |
-
|
| 15 |
-
|
| 16 |
-
|
| 17 |
-
|
| 18 |
-
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
| 19 |
</html>
|
|
|
|
| 1 |
<!DOCTYPE html>
|
| 2 |
<html>
|
| 3 |
+
|
| 4 |
+
<head>
|
| 5 |
+
|
| 6 |
+
<link rel="stylesheet" href="https://ebi.emblstatic.net/web_guidelines/EBI-Icon-fonts/v1.2/fonts.css" type="text/css" media="all"/>
|
| 7 |
+
<script src="https://d3js.org/d3.v4.min.js" charset="utf-8"></script>
|
| 8 |
+
<script type="text/javascript" src="https://www.ebi.ac.uk/pdbe/pdb-component-library/js/protvista-pdb-3.3.0.js"></script>
|
| 9 |
+
|
| 10 |
+
</head>
|
| 11 |
+
|
| 12 |
+
<body>
|
| 13 |
+
<h4>ProtVista PDB custom data demo</h4>
|
| 14 |
+
|
| 15 |
+
<div>
|
| 16 |
+
<protvista-pdb custom-data="true" id="pv1"></protvista-pdb>
|
| 17 |
+
</div>
|
| 18 |
+
|
| 19 |
+
<script>
|
| 20 |
+
document.addEventListener('DOMContentLoaded', () => {
|
| 21 |
+
|
| 22 |
+
//Get web-component element
|
| 23 |
+
const pvInstance = document.getElementById('pv1');
|
| 24 |
+
if(!pvInstance) return;
|
| 25 |
+
(async () => {
|
| 26 |
+
|
| 27 |
+
// PDBe sequence conservation api data
|
| 28 |
+
let scFetch = await fetch('https://www.ebi.ac.uk/pdbe/graph-api/uniprot/sequence_conservation/P29373');
|
| 29 |
+
let scResponseData = await scFetch.json();
|
| 30 |
+
const seqConservationData = scResponseData;
|
| 31 |
+
// seqConservationData is a json array with following fields. Please refer the fetch api url for the data struture
|
| 32 |
+
// [
|
| 33 |
+
// {
|
| 34 |
+
// "start": 1,
|
| 35 |
+
// "end": 1,
|
| 36 |
+
// "conservation_score": 1,
|
| 37 |
+
// "tooltipContent": "Conservation score: 1",
|
| 38 |
+
// "amino": [
|
| 39 |
+
// {
|
| 40 |
+
// "end": 1,
|
| 41 |
+
// "letter": "P",
|
| 42 |
+
// "proba": 0.428,
|
| 43 |
+
// "start": 1,
|
| 44 |
+
// "color": "#c0c000",
|
| 45 |
+
// "tooltipContent": "Amino acid: PRO<br/>Probability: 42.80%"
|
| 46 |
+
// },...
|
| 47 |
+
// ]
|
| 48 |
+
// }...
|
| 49 |
+
// ]
|
| 50 |
+
|
| 51 |
+
// PDBe variation api data
|
| 52 |
+
let vrFetch = await fetch('https://www.ebi.ac.uk/pdbe/graph-api/uniprot/protvista/variation/P29373');
|
| 53 |
+
let vrResponseData = await vrFetch.json();
|
| 54 |
+
const variationData = vrResponseData;
|
| 55 |
+
// variationData is a json with following fields. Please refer the fetch api url for the data struture
|
| 56 |
+
// {
|
| 57 |
+
// "sequence": "PNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRE",
|
| 58 |
+
// "variants": [
|
| 59 |
+
// {
|
| 60 |
+
// "accession": "NC_000001.11:g.156705439T>C",
|
| 61 |
+
// "association": [],
|
| 62 |
+
// "clinicalSignificances": null,
|
| 63 |
+
// "color": "#002594",
|
| 64 |
+
// "end": "2",
|
| 65 |
+
// "polyphenScore": 0.003,
|
| 66 |
+
// "siftScore": 0.055,
|
| 67 |
+
// "sourceType": "large_scale_study",
|
| 68 |
+
// "start": "2",
|
| 69 |
+
// "tooltipContent": "XYZ Variant",
|
| 70 |
+
// "variant": "S",
|
| 71 |
+
// "xrefNames": [
|
| 72 |
+
// "gnomAD"
|
| 73 |
+
// ],
|
| 74 |
+
// "keywords": [ // Keywords are used to filter the variats
|
| 75 |
+
// "predicted",
|
| 76 |
+
// "large_scale_studies"
|
| 77 |
+
// ]
|
| 78 |
+
// },...
|
| 79 |
+
// ]
|
| 80 |
+
// }
|
| 81 |
+
|
| 82 |
+
|
| 83 |
+
//Custom data model
|
| 84 |
+
const customData = {
|
| 85 |
+
displayNavigation: true, // Set to false to hide navigation scale
|
| 86 |
+
displaySequence: true, // Set to false to hide sequence track
|
| 87 |
+
sequence: 'MPNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRE', //Protein sequence
|
| 88 |
+
length: 138, // Length of the sequence
|
| 89 |
+
offset: 1, // Offset navigation scale start. Example offset:10 will display the navigation start from 10 instead of default 1.
|
| 90 |
+
tracks: [ // Array of track objects (PDBe implementation extends core ProtVista track component. Refer - https://github.com/ebi-webcomponents/nightingale/tree/master/packages/protvista-track#data-array for all the supported track properties )
|
| 91 |
+
{
|
| 92 |
+
label: "Domains", // Track label
|
| 93 |
+
labelType: "text", // Supported values 'text' and 'html'
|
| 94 |
+
data: [
|
| 95 |
+
{
|
| 96 |
+
accession: "d1", // Some unique id
|
| 97 |
+
type: "UniProt range", // Displayed in tooltip title
|
| 98 |
+
label: "Domain 1", // Expected values 'text' and 'html'
|
| 99 |
+
labelTooltip: "Residues mapped to domain 1", // Label tooltip content. Support text and HTML mark-up
|
| 100 |
+
locations: [ // Array of sub-tracks
|
| 101 |
+
{
|
| 102 |
+
fragments : [ // Array of sub-track fragments
|
| 103 |
+
{
|
| 104 |
+
start: 1, // Track start value
|
| 105 |
+
end: 56, // Track end value
|
| 106 |
+
tooltipContent: "Type: domain 1<br>Range: XYZ1 - XYZ56", // track tooltip content. Support text and HTML mark-up
|
| 107 |
+
color: "rgb(135,158,247)" // track (fragment) colour, supported rgb and hex code value
|
| 108 |
+
},
|
| 109 |
+
{
|
| 110 |
+
start: 70,
|
| 111 |
+
end: 130,
|
| 112 |
+
tooltipContent: "Type: domain 1<br>Range: XYZ70 - XYZ130",
|
| 113 |
+
color: "rgb(160,174,232)"
|
| 114 |
+
}
|
| 115 |
+
]
|
| 116 |
+
}
|
| 117 |
+
]
|
| 118 |
+
},
|
| 119 |
+
{
|
| 120 |
+
accession: "d2",
|
| 121 |
+
type: "UniProt range",
|
| 122 |
+
label: "<div><i class='icon icon-generic' data-icon=';' style='color: #000;'></i> <a href='resource.xyz'>Domain 2</a></div>", //HTML strcutured label with font-icons. You can add any HTML markup.
|
| 123 |
+
labelTooltip: "<strong>Domain Compound</strong><br><img src='https://www.ebi.ac.uk/pdbe/static/files/pdbechem_v2/REA_200.svg'>", // labelTooltip HTML mark-up example displaying compound image in the tooltip.
|
| 124 |
+
locations: [
|
| 125 |
+
{
|
| 126 |
+
fragments : [
|
| 127 |
+
{
|
| 128 |
+
start: 1,
|
| 129 |
+
end: 20,
|
| 130 |
+
tooltipContent: "<strong>Type: domain 2</strong><br>Range: XY1 - XYZ20<br><a href='resource.xyz' style='color:blue'>view details</a>", // tooltipContent HTML mark-up example
|
| 131 |
+
color: "rgb(107,119,39)"
|
| 132 |
+
},
|
| 133 |
+
{
|
| 134 |
+
start: 22,
|
| 135 |
+
end: 137,
|
| 136 |
+
tooltipContent: "Type: domain 2<br>Range: XYZ22 - XYZ137",
|
| 137 |
+
color: "rgb(90,102,23)"
|
| 138 |
+
}
|
| 139 |
+
]
|
| 140 |
+
}
|
| 141 |
+
]
|
| 142 |
+
}
|
| 143 |
+
]
|
| 144 |
+
|
| 145 |
+
},
|
| 146 |
+
{
|
| 147 |
+
label: "Annotations",
|
| 148 |
+
labelType: "text",
|
| 149 |
+
labelColor: "rgb(128,128,128)", // Set labelColor to change label background colour
|
| 150 |
+
data: [
|
| 151 |
+
{
|
| 152 |
+
accession: "a1",
|
| 153 |
+
type: "UniProt range",
|
| 154 |
+
label: "Annotations 1",
|
| 155 |
+
labelType: "text",
|
| 156 |
+
labelTooltip: "Residues mapped to annotations 1",
|
| 157 |
+
labelColor: "rgb(211,211,211)",
|
| 158 |
+
color: "rgb(255,99,163)",
|
| 159 |
+
locations: [
|
| 160 |
+
{
|
| 161 |
+
fragments : [
|
| 162 |
+
{
|
| 163 |
+
start: 1,
|
| 164 |
+
end: 56,
|
| 165 |
+
tooltipContent: "Type: domain 1<br>Range: XYZ1 - XYZ56"
|
| 166 |
+
},
|
| 167 |
+
{
|
| 168 |
+
start: 70,
|
| 169 |
+
end: 130,
|
| 170 |
+
tooltipContent: "Type: domain 1<br>Range: XYZ70 - XYZ130"
|
| 171 |
+
}
|
| 172 |
+
]
|
| 173 |
+
}
|
| 174 |
+
]
|
| 175 |
+
}
|
| 176 |
+
]
|
| 177 |
+
|
| 178 |
+
},
|
| 179 |
+
{
|
| 180 |
+
label: "Annotation shapes",
|
| 181 |
+
data: [
|
| 182 |
+
{
|
| 183 |
+
accession: "s1",
|
| 184 |
+
type: "UniProt range",
|
| 185 |
+
label: "Circle",
|
| 186 |
+
color: "rgb(249,166,2)",
|
| 187 |
+
shape: 'circle', // supported shapes rectangle|bridge|diamond|chevron|catFace|triangle|wave|hexagon|pentagon|circle|arrow|doubleBar,
|
| 188 |
+
locations: [
|
| 189 |
+
{
|
| 190 |
+
fragments : [
|
| 191 |
+
{
|
| 192 |
+
start: 5,
|
| 193 |
+
end: 5,
|
| 194 |
+
tooltipContent: "Type: domain 1<br>Range: XYZ1 - XYZ56",
|
| 195 |
+
},
|
| 196 |
+
{
|
| 197 |
+
start: 9,
|
| 198 |
+
end: 9,
|
| 199 |
+
tooltipContent: "Type: domain 1<br>Range: XYZ70 - XYZ130"
|
| 200 |
+
}
|
| 201 |
+
]
|
| 202 |
+
}
|
| 203 |
+
]
|
| 204 |
+
},
|
| 205 |
+
{
|
| 206 |
+
accession: "s2",
|
| 207 |
+
type: "UniProt range",
|
| 208 |
+
label: "Diamond",
|
| 209 |
+
shape: 'diamond',
|
| 210 |
+
color: "rgb(255,99,163)", // Default colour value for all fragments in this track
|
| 211 |
+
locations: [
|
| 212 |
+
{
|
| 213 |
+
fragments : [
|
| 214 |
+
{
|
| 215 |
+
start: 5,
|
| 216 |
+
end: 5,
|
| 217 |
+
tooltipContent: "Type: domain 1<br>Range: XYZ1 - XYZ56"
|
| 218 |
+
},
|
| 219 |
+
{
|
| 220 |
+
start: 9,
|
| 221 |
+
end: 9,
|
| 222 |
+
color: "rgb(0,128,129)", // Set colour here for individual shape fragment. This will override the track default colour.
|
| 223 |
+
tooltipContent: "Type: domain 1<br>Range: XYZ70 - XYZ130"
|
| 224 |
+
},
|
| 225 |
+
{
|
| 226 |
+
start: 20,
|
| 227 |
+
end: 20,
|
| 228 |
+
tooltipContent: "Type: domain 1<br>Range: XYZ70 - XYZ130"
|
| 229 |
+
},
|
| 230 |
+
{
|
| 231 |
+
start: 22,
|
| 232 |
+
end: 22,
|
| 233 |
+
tooltipContent: "Type: domain 1<br>Range: XYZ70 - XYZ130"
|
| 234 |
+
}
|
| 235 |
+
]
|
| 236 |
+
}
|
| 237 |
+
]
|
| 238 |
+
}
|
| 239 |
+
]
|
| 240 |
+
|
| 241 |
+
}
|
| 242 |
+
],
|
| 243 |
+
sequenceConservation: seqConservationData, // Set this property to display your own sequence conservation data. Refer comments at the top for data structure.
|
| 244 |
+
variants: variationData, // Set this property to display your own variation data. Refer comments at the top for data structure.
|
| 245 |
+
legends: {
|
| 246 |
+
alignment: 'right', // expected values 'left', 'right' or 'center'
|
| 247 |
+
data: { // Legend Row, key is used as the row label
|
| 248 |
+
"Domains": [ // legends for Domains row
|
| 249 |
+
{
|
| 250 |
+
color: ["rgb(135,158,247)", "rgb(160,174,232)"], // legend color, supported rgb and hex code value
|
| 251 |
+
text: "Domains 1" // legend text
|
| 252 |
+
},
|
| 253 |
+
{
|
| 254 |
+
color: ["rgb(107,119,39)", "rgb(90,102,23)"],
|
| 255 |
+
text: "Domains 2"
|
| 256 |
+
}
|
| 257 |
+
],
|
| 258 |
+
"Annotations": [ // legends for Annotation row row
|
| 259 |
+
{
|
| 260 |
+
color: ["rgb(255,99,163)"],
|
| 261 |
+
text: "Custom Annotations"
|
| 262 |
+
}
|
| 263 |
+
]
|
| 264 |
+
}
|
| 265 |
+
}
|
| 266 |
+
};
|
| 267 |
+
|
| 268 |
+
// Assign custom data object to instance viewerdata property
|
| 269 |
+
pvInstance.viewerdata = customData;
|
| 270 |
+
|
| 271 |
+
})();
|
| 272 |
+
|
| 273 |
+
});
|
| 274 |
+
</script>
|
| 275 |
+
|
| 276 |
+
|
| 277 |
+
</body>
|
| 278 |
+
|
| 279 |
</html>
|